Please use this identifier to cite or link to this item: http://repositorio.unicamp.br/jspui/handle/REPOSIP/95000
Type: Artigo de periódico
Title: Isolation And Characterization Of A Convulxin-like Protein From Crotalus Durissus Collilineatus Venom
Author: Toyama M.H.
Carneiro E.M.
Marangoni S.
Amaral M.E.C.
Velloso L.A.
Boschero A.C.
Abstract: A convulxin (Cvx)-like protein was isolated from Crotalus durissus collilineatus venom by a combination of molecular exclusion and reversed-phase HPLC chromatographies. The molecular mass of the Cvx-like protein in the absence and presence of DTT was 78 kDa and 12-13 kDa, respectively. The Cvx-like protein consisted of two nonidentical polypeptide chains (α and β). The N-terminal amino-acid sequences of the α and β subunits were GLHCPSDWYAYDGHCYKIFNEEMNWED and GFCCPSHWSSYSRYCYKFFSQEMNWEDAEK, respectively, with both subunits having a high content of Glu, Ser, Cys, and Asp. The Cvx-like protein showed high homology with other venom C-type lectins, but had low hemagglutinating activity on intact and trypsinized erythrocytes. The Cvx-like protein stimulated insulin receptor phosphorylation and potentiated insulin secretion from isolated islets in the presence of sub- (2.8 mM) or supra-physiological (16.7 mM) glucose concentrations. These results suggest that the increase in insulin secretion induced by Cvx-like protein may be mediated by a protein tyrosine kinase-dependent pathway and may involve other membrane receptors, such as GP VI or Scr family proteins.
Editor: 
Rights: fechado
Identifier DOI: 10.1023/A:1013377331569
Address: http://www.scopus.com/inward/record.url?eid=2-s2.0-0035704759&partnerID=40&md5=fc9a4420d4fa31be6bc8d8a54d5b65dc
Date Issue: 2001
Appears in Collections:Unicamp - Artigos e Outros Documentos

Files in This Item:
There are no files associated with this item.


Items in DSpace are protected by copyright, with all rights reserved, unless otherwise indicated.