Please use this identifier to cite or link to this item:
Type: Artigo de periódico
Title: Determination Of The Amino Acid Sequence Of A New Phospholipase A 2 (midca1) Isolated From Micrurus Dumerilii Carinicauda Venom
Author: Dal Belo C.A.
Toyama M.H.
Toyama D.D.O.
Marangoni S.
Moreno F.B.
Cavada B.S.
Fontana M.D.
Hyslop S.
Carneiro E.M.
Boschero A.C.
Abstract: A new Phospholipase A2 (PLA2) from Micrurus dumerilii carinicauda venom was isolated and its primary structure determined. This new PLA2 showed a low enzymatic activity when compared with other PLA2s and it is moderately basic with an isoelectric point of 8.0. Its amino acid sequence showed the presence of 120 amino acid residues and its sequence was: NLIQFLNMIQCTTPGREPLVAFANYGCYCGRGGSGTPVDELDRCCQVHDNCYDTAKKVFGCSPYFTMYSY DCSEGKLTCKDNNTKCKAAVCNCDRTAALCFAKAPYNDKNYKIDLTKRCQ. The structural model of MIDCA1, when compared with other strong neurotoxic PLA2s, such as Naja naja, showed significant differences in the β-wing and neurotoxic sites, despite the high level of amino acid sequence similarity. These observations indicate a dissociation between the biological and catalytic activity of this new PLA2, supporting the view that other regions of the protein are involved in the biological effects. © 2005 Springer Science+Business Media, Inc.
Citation: Protein Journal. , v. 24, n. 3, p. 147 - 153, 2005.
Rights: fechado
Identifier DOI: 10.1007/s10930-005-7838-1
Date Issue: 2005
Appears in Collections:Unicamp - Artigos e Outros Documentos

Files in This Item:
File Description SizeFormat 
2-s2.0-23844481766.pdf384.92 kBAdobe PDFView/Open

Items in DSpace are protected by copyright, with all rights reserved, unless otherwise indicated.