Please use this identifier to cite or link to this item: http://repositorio.unicamp.br/jspui/handle/REPOSIP/196484
Type: Artigo de periódico
Title: Biochemical, Pharmacological And Structural Characterization Of A New Pla2 From Crotalus Durissus Terrificus (south American Rattlesnake) Venom.
Author: Hernandez-Oliveira, Saraguaci
Toyama, Marcos Hikari
Toyama, Daniela Oliveira
Marangoni, Sergio
Hyslop, Stephen
Rodrigues-Simioni, Léa
Abstract: A new PLA2 (F16) was purified from Crotalus durissus terrificus venom by molecular exclusion chromatography followed by analytical reverse phase HPLC. The PLA2 (14.86 kDa by MALDI-TOF mass spectrometry) had an amino acid sequence of SLLQFNKMIKFETRKNAVPFYAFYGCYCGWGGRRRPKDATDRCCFVHDCCYEKVTKCNTKWDIYRYSLKSGYITCGKGTWCKEQICECDRVAAECLRRSLSTYKNGYMFYPDSRCRGPSETC, and showed highly conserved Ca2+-binding and catalytic sites. F16 showed allosteric behavior with 10 mM Ca2+ and had temperature and pH optima of 25 degrees C and 7.9, respectively. F16 (10 microg/ml) produced neuromuscular blockade in chick biventer cervicis preparations in the absence and presence of crotapotin, indicating that crotapotin was not essential for neuromuscular action in this preparation. In contrast, in mouse phrenic nerve-diaphragm preparations, the neuromuscular blockade produced by the same concentration of toxin was dependent on crotapotin. Pre-incubation with heparin markedly reduced the neurotoxicity of F16. These results show that the biochemical and structural properties of F16 are similar to those of the PLA2 isoforms F15 and F17, but that the neurotoxicity and the requirement for crotapotin to form the crotoxin complex varies according to the neuromuscular preparation.
Subject: Amino Acid Sequence
Animals
Chickens
Chromatography, Gel
Chromatography, High Pressure Liquid
Crotalid Venoms
Crotalus
Diaphragm
Male
Mice
Molecular Sequence Data
Neuromuscular Junction
Phospholipases A
Phospholipases A2
Phrenic Nerve
Sequence Alignment
Spectrometry, Mass, Matrix-assisted Laser Desorption-ionization
Rights: fechado
Identifier DOI: 10.1007/s10930-005-6718-z
Address: http://www.ncbi.nlm.nih.gov/pubmed/16283546
Date Issue: 2005
Appears in Collections:Unicamp - Artigos e Outros Documentos

Files in This Item:
File SizeFormat 
pmed_16283546.pdf365.45 kBAdobe PDFView/Open


Items in DSpace are protected by copyright, with all rights reserved, unless otherwise indicated.